activin A receptor, type IIB, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ACVR2B.

Brand:  Abnova H00000093-A01.50uL

Product Code. 16194334

Description

Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor. [provided by RefSeq

Sequence: RGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG

Specifications

• Antigen: activin A receptor, type IIB
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ACVR2B.
• Gene: ACVR2B
• Gene Alias: ACTRIIB/ActR-IIB/MGC116908
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_001106
• Gene Symbols: ACVR2B
• Immunogen: ACVR2B (NP_001097, 21 a.a. ∼ 120 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 93
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.