ATP-binding cassette, sub-family C (CFTR/MRP), member 6, Mouse, Clone: 5D8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ABCC6.

Brand:  Abnova H00000368-M02.100ug

Product Code. 16184804

Description

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq

Sequence: IAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV

Specifications

• Antigen: ATP-binding cassette, sub-family C (CFTR/MRP), member 6
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001171
• Gene Symbols: ABCC6
• Immunogen: ABCC6 (NP_001162, 831 a.a. ∼ 930 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 368
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ

• Applications: ELISA, Western Blot
• Clone: 5D8
• Description: Mouse monoclonal antibody raised against a partial recombinant ABCC6.
• Gene: ABCC6
• Gene Alias: ABC34/ARA/EST349056/MLP1/MOATE/MRP6/PXE/PXE1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody