aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant AASDHPPT.

Brand:  Abnova H00060496-A01.50uL

Product Code. 16159436

Beskrivning

The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. [provided by RefSeq

Sequence: MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSS

Specifikationer

• Antigen: aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant AASDHPPT.
• Gene: AASDHPPT
• Gene Alias: AASD-PPT/CGI-80/DKFZp566E2346/LYS2/LYS5
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 60496
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_015423
• Gene Symbols: AASDHPPT
• Immunogen: AASDHPPT (NP_056238, 1 a.a. ∼ 99 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum