missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Annexin A4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59120
This item is not returnable.
View return policy
Description
Annexin A4 Polyclonal specifically detects Annexin A4 in Human, Rat, Porcine samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Annexin A4 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| annexin A4, Annexin IV, annexin IV (placental anticoagulant protein II), annexin-4, ANX4Carbohydrate-binding protein p33/p41, Chromobindin-4, chromobindin-4,35-beta calcimedin, DKFZp686H02120, Endonexin I, Lipocortin IV, MGC75105, P32.5, PAP-II, PIG28, Placental anticoagulant protein II, PP4-X, proliferation-inducing gene 28, proliferation-inducing protein 28, Protein II, ZAP36 | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| Q6LES2 | |
| ANXA4 | |
| Synthetic peptides corresponding to ANXA4 (annexin A4) The peptide sequence was selected from the N terminal of ANXA4. Peptide sequence GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ. | |
| 100 μL | |
| Cancer | |
| 307 | |
| Human, Rat, Pig, Bovine, Canine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction