missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ANKS3 Antibody, Novus Biologicals™

ANKS3 Antibody, Novus Biologicals™

Product Code. 18400041 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18400041 0.1 mL 0.10mL
18490141 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18400041 Supplier Novus Biologicals Supplier No. NBP183532

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ANKS3 Polyclonal antibody specifically detects ANKS3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen ANKS3
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias ankyrin repeat and SAM domain-containing protein 3, ankyrin repeat and sterile alpha motif domain containing 3, FLJ32767, KIAA1977FLJ32345
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LNHGVKVDARDHSGATARMLAKQYGHMKIVALMDTYSPSLPKSLYRSPEKYEDLSSSDESCPAPQRQRPCRKKGVSI
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 124401
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.