ANKRD45 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18489411	Novus Biologicals NBP1-85421-25ul	25 μL
18281678	Novus Biologicals NBP1-85421	0.1 mL

Description

ANKRD45 Polyclonal specifically detects ANKRD45 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ANKRD45
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ankyrin repeat domain 45, ankyrin repeat domain-containing protein 45, cancer/testis antigen 117, CT117, FLJ45235, MGC161631, MGC161633, RP3-436N22.4
• Gene Symbols: ANKRD45
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q5TZF3
• Gene ID (Entrez): 339416
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KEDKNTILSACRAKNEWLETHTEASINELFEQRQQLEDIVTPIFTKMTTPCQVKSAKSVTSHDQKRSQDDTSN
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only