ANKRD44 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Product Code	Brand	Quantity
18476340	Novus Biologicals NBP1-80887-25ul	25ul
18273837	Novus Biologicals NBP1-80887	0.1 mL

Description

ANKRD44 Polyclonal specifically detects ANKRD44 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ANKRD44
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ankyrin repeat domain 44, FLJ11570, MGC21968, MGC70444, PP6-ARS-BAnkyrin repeat domain-containing protein 44, protein phosphatase 6 ankyrin repeat subunit B, serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B, Serine/threonine-protein phosphatase 6 regulatory subunit ARS-B
• Gene Symbols: ANKRD44
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q8N8A2
• Gene ID (Entrez): 91526
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIR
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only