missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ANKFY1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

ANKFY1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18324915 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18324915 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18324915 Supplier Novus Biologicals Supplier No. NBP310700100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ANKFY1 Polyclonal specifically detects ANKFY1 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ANKFY1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias ANKHZN, ankyrin repeat and FYVE domain containing 1, ankyrin repeat and FYVE domain-containing protein 1, ankyrin repeat hooked to zinc finger motif, ankyrin repeats hooked to a zinc finger motif, DKFZp686M19106, KIAA1255, Rabankyrin-5, ZFYVE14
Host Species Rabbit
Immunogen The immunogen for Anti-ANKFY1 antibody is: synthetic peptide directed towards the N-terminal region of Human ANFY1 (XP_005256736.1). Peptide sequence TPLHLVALYSSKKHSADVMSEMAQIAEALLQAGANPNMQDSKGRTPLHVS
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51479
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.