Invitrogen™ ANGPTL2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA578776

Product Code. 15994355

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat stomach tissue, mouse ovary tissue. IHC: mouse intestine tissue, rat intestine tissue, rat cardiac muscle tissue, human intetsinal cancer tissue.

Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. The protein encoded by this gene is another member of the angiopoietin family that is widely expressed in adult tissues with mRNA levels highest in highly vascularized tissues. This protein was found to be a secretory protein that does not act as an endothelial cell mitogen in vitro.

Specifications

• Antigen: ANGPTL2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ANGPTL2
• Gene Alias: AI593246; angiopoietin like 2; angiopoietin related protein 2; angiopoietin-like 2; angiopoietin-like protein 2; Angiopoietin-related protein 2; angiopoietin-related protein-2; Angptl2; ARP2; AW260363; HARP; MGC8889; UNQ170/PRO196
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 171100, 23452, 26360
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: Q9R045, Q9UKU9
• Gene Symbols: ANGPTL2
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ANGPTL2 (275-312aa WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG