missing translation for 'onlineSavingsMsg'
Learn More

Angiopoietin-like Protein 4/ANGPTL4 Antibody, Novus Biologicals™

Product Code. 18397909 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18397909 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18397909 Supplier Novus Biologicals Supplier No. H00051129B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

Angiopoietin-like Protein 4/ANGPTL4 Polyclonal antibody specifically detects Angiopoietin-like Protein 4/ANGPTL4 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen Angiopoietin-like Protein 4/ANGPTL4
Applications Western Blot, ELISA
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA
Formulation PBS (pH 7.4)
Gene Accession No. NP_647475.1
Gene Alias angiopoietin-like 4, Angiopoietin-like protein 4, ARP4fasting-induced adipose factor, FIAFhepatic angiopoietin-related protein, Hepatic fibrinogen/angiopoietin-related protein, HFARPANGPTL2, NL2, peroxisome proliferator-activated receptor (PPAR) gamma inducedangiopoietin-related protein, PGARangiopoietin-related protein 4, pp1158, PPARG angiopoietin related protein
Host Species Mouse
Immunogen ANGPTL4 (NP_647475.1, 1 a.a. - 406 a.a.) full-length human protein. MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Apoptosis
Primary or Secondary Primary
Gene ID (Entrez) 51129
Target Species Human, Mouse, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.