missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Ancient ubiquitous protein 1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Ancient ubiquitous protein 1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Product Code. 18336684 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18336684 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18336684 Lieferant Novus Biologicals Lieferanten-Nr. NBP310648100UL

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

Ancient ubiquitous protein 1 Polyclonal specifically detects Ancient ubiquitous protein 1 in Mouse samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen Ancient ubiquitous protein 1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias ancient ubiquitous protein 1
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ancient ubiquitous protein 1 (NP_031543). Peptide sequence MPKDSAFPGAPAALRRWRRQRPRSPEAAAMEPPPAPGPERLFDSHRLPSD
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 550
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.