missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AMSH-LP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-89135
This item is not returnable.
View return policy
Description
AMSH-LP Polyclonal specifically detects AMSH-LP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| AMSH-LP | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q96FJ0 | |
| STAMBPL1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLS | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human AMSH-LP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ALMalpha, AMSH-FP, AMSHLP, AMSH-LPassociated molecule with the SH3 domain of STAM (AMSH) - Family Protein, associated molecule with the SH3 domain of STAM (AMSH) like protein, bA399O19.2, EC 3.1.2.15, EC 3.4.19.-, FLJ31524, KIAA1373AMSH-like protease, STAM binding protein-like 1, STAM-binding protein-like 1 | |
| Rabbit | |
| 50 kDa | |
| 0.1 mL | |
| DNA replication Transcription Translation and Splicing | |
| 57559 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction