Learn More
Invitrogen™ AMPK beta-2 Monoclonal Antibody (6G1)

Mouse Monoclonal Antibody
Brand: Invitrogen™ MA533002
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human placenta tissue, human 293T whole cell, human A549 whole cell, human A375 whole cell, human A431 whole cell, human U20S whole cell, human K562 whole cell. Flow: PC-3 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
AMPK Beta 2 is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex.
Specifications
| AMPK beta-2 | |
| Monoclonal | |
| 500 μg/mL | |
| PBS with 4mg trehalose and 0.05mg sodium azide | |
| O43741 | |
| Prkab2 | |
| A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56-89aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE). | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody | |
| IgG2b |
| Flow Cytometry, Immunohistochemistry (Frozen), Western Blot, Immunocytochemistry | |
| 6G1 | |
| Unconjugated | |
| Prkab2 | |
| 5730553K21Rik; 5'-AMP-activated protein kinase subunit beta-2; 5'-AMP-activated protein kinase, beta-2 subunit; AMP-activated protein kinase beta 2 non-catalytic subunit; AMP-activated protein kinase beta-2 regulatory subunit; AMPK beta 2; AMPK beta-2 chain; AMPK subunit beta-2; AMPKbeta2; AW049591; BB124140; Prkab2; protein kinase AMP-activated non-catalytic subunit beta 2; protein kinase, AMP-activated, beta 2 non-catalytic subunit | |
| Mouse | |
| Affinity chromatography | |
| RUO | |
| 5565 | |
| -20°C | |
| Lyophilized |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.