missing translation for 'onlineSavingsMsg'
Learn More

Amphiphysin/AMPH Antibody, Novus Biologicals™

Código de producto. 18407350 Tienda Bio Techne Productos
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Tamaño de la unidad:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity unitSize
18407350 0.1 mL 0.10mL
18403611 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18407350 Proveedor Novus Biologicals N.º de proveedor NBP186033

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

Amphiphysin/AMPH Polyclonal antibody specifically detects Amphiphysin/AMPH in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Amphiphysin/AMPH
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias AMPH1, amphiphysin, amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), amphiphysin (Stiff-Mann syndrome with breast cancer 128kD autoantigen), amphiphysin I
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: PGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRRL
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Immune System Diseases, Immunology, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 273
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.