missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AMPD3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58694-25ul
This item is not returnable.
View return policy
Description
AMPD3 Polyclonal specifically detects AMPD3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| AMPD3 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| adenosine monophosphate deaminase (isoform E), adenosine monophosphate deaminase 3, AMP aminohydrolase, AMP deaminase 3, AMP deaminase isoform E, EC 3.5.4.6, Erythrocyte AMP deaminase, erythrocyte type AMP deaminase, erythrocyte-specific AMP deaminase, myoadenylate deaminase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 272 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| AMPD3 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PYCLDDAPPNLDYLVHMQGGILFVYDNKKMLEHQEPHSLPYPDLETYTVDMSHILALITDGPTKTYCHRRLNFLES | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur