CD8 Antibody (CL1529), R&D Systems™

Artikelnummer.	Quantity	Packungsgröße
18608625	25 μL	25µL
18173519	0.1 mL	0.1mL

Artikelnummer. 18608625 Lieferant Novus Biologicals Lieferanten-Nr. NBP23674325ul

Beschreibung

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

CD8 Monoclonal specifically detects CD8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Spezifikation

• Antigen: CD8
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Classification: Monoclonal
• Clone: CL1529
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Accession No.: P01732
• Gene Alias: CD8, CD8a molecule, LEU2, p32
• Gene Symbols: CD8A
• Host Species: Mouse
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT
• Purification Method: Protein A purified
• Quantity: 25 μL
• Regulatory Status: RUO
• Research Discipline: Innate Immunity
• Primary or Secondary: Primary
• Gene ID (Entrez): 925
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Reconstitution: Protein A purified
• Target Species: Human
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG1
• Product Line: Novus

For Research Use Only