missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aminopeptidase P2/XPNPEP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£356.00 - £559.00
Specifications
| Antigen | Aminopeptidase P2/XPNPEP2 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18641445
|
Novus Biologicals
NBP3-21303-100ul |
100 μg |
£559.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18627614
|
Novus Biologicals
NBP3-21303-25ul |
25 μg |
£356.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Aminopeptidase P2/XPNPEP2 Polyclonal antibody specifically detects Aminopeptidase P2/XPNPEP2 in Human samples. It is validated for ImmunofluorescenceSpecifications
| Aminopeptidase P2/XPNPEP2 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Aminoacylproline aminopeptidase, APP2, EC 3.4.11.9, mAmP, Membrane-bound aminopeptidase P, Membrane-bound AmP, Membrane-bound APP, xaa-Pro aminopeptidase 2, X-Pro aminopeptidase 2, X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTW | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 7512 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title