missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aminopeptidase O/ONPEP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | Aminopeptidase O/ONPEP |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18266412
|
Novus Biologicals
NBP2-57309 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18637316
|
Novus Biologicals
NBP2-57309-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Aminopeptidase O/ONPEP Polyclonal specifically detects Aminopeptidase O/ONPEP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Aminopeptidase O/ONPEP | |
| Polyclonal | |
| Rabbit | |
| Human | |
| aminopeptidase O, AOPEP, APO, AP-OFLJ55832, C90RF3, chromosome 9 open reading frame 3, EC 3.4.11.-, FLJ14675, FLJ40923, ONPEP | |
| C9ORF3 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 84909 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LFDTDTWSLQIRKTGAQTATDFPHAIRIWYKTKPEGRSVTWTSDQSGRPCVYTVGSPINNRALFPCQEPPVAMSTWQATVRAAASFVVLMSGENSAKPT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title