missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Amiloride-sensitive cation channel 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£285.00 - £423.00
Specifica
| Antigen | Amiloride-sensitive cation channel 3 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Descrizione
Amiloride-sensitive cation channel 3 Polyclonal antibody specifically detects Amiloride-sensitive cation channel 3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifica
| Amiloride-sensitive cation channel 3 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol | |
| 9311 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Acid-sensing ion channel 3, amiloride-sensitive cation channel 3, amiloride-sensitive cation channel 3, testis, ASIC3hTNaC1, DRASIC, hASIC3, modulatory subunit of ASIC2a, Neuronal amiloride-sensitive cation channel 3, proton-gated cation channel subunit, SLNAC1, Testis sodium channel 1, TNAC1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: CNINPLRRSRLTPNDLHWAGSALLGLDPAEHAAFLRALGRPPAPPGFMPSPTFDMAQLYARAGHSLDDMLLDCRFRGQPCGPENFTTIFTRM | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto