missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AMDHD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Description
AMDHD1 Polyclonal antibody specifically detects AMDHD1 in Human samples. It is validated for Immunofluorescence
Spécification
Spécification
| Antigen | AMDHD1 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | amidohydrolase domain containing 1, Amidohydrolase domain-containing protein 1, EC 3.5.2.7, MGC35366, probable imidazolonepropionase |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DEGVIVALGSDFNPNAYCFSMPMVMHLACVNMRMSMPEALAAATINAAYALGKSHTHGSLEVGKQGDLIIINSSRWEHLIYQFG |
| Purification Method | Affinity purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?