missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aly Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10855-100UL
This item is not returnable.
View return policy
Description
Aly Polyclonal specifically detects Aly in Mouse samples. It is validated for Western Blot.
Specifications
| Aly | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| Ally of AML-1 and LEF-1, ALY/REF, ALYBEFbZIP enhancing factor, bZIP-enhancing factor BEF, REF, THO complex 4, THO complex subunit 4, tho4, Transcriptional coactivator Aly/REF | |
| The immunogen is a synthetic peptide directed towards the N terminal region of mouse REFBP2 (NP_062357.3). Peptide sequence KMDMSLDDIIKLNRNQRRVNRGGGPRRNRPAIARGGRNRPAPYSRPKPLP | |
| 100 μg | |
| Primary | |
| Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 10189 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction