missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Beskrivelse
ALX3 Polyclonal antibody specifically detects ALX3 in Human samples. It is validated for Immunofluorescence
Tekniske data
Tekniske data
| Antigen | ALX3 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | ALX homeobox 3, aristaless-like homeobox 3, homeobox protein aristaless-like 3, MGC138212, MGC141988, Proline-rich transcription factor ALX3 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PAEAEEKTSKAASFPQLPLDCRGGPRDGPSNLQGSPGPCLASLHLPLSPGLPDSMELAKN |
| Purification Method | Affinity purified |
| Vis mere |
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?