ALS2CR4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18421122	Novus Biologicals NBP2-33656-25ul	25 μL
18181282	Novus Biologicals NBP2-33656	0.1 mL

Description

ALS2CR4 Polyclonal specifically detects ALS2CR4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ALS2CR4
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 4, amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein, N-terminus truncated
• Gene Symbols: TMEM237
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q96Q45
• Gene ID (Entrez): 65062
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ELQYANELGVEDEDIITDEQTTVEQQSVFTAPTGISQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKP
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only