missing translation for 'onlineSavingsMsg'
Learn More

ALPPL2 Antibody (2B3), Novus Biologicals™

Product Code. 18340638 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18340638 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18340638 Supplier Novus Biologicals Supplier No. H00000251M07

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

ALPPL2 Monoclonal antibody specifically detects ALPPL2 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), ELISA, ELISA, KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen ALPPL2
Applications Western Blot, ELISA, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), Sandwich ELISA, Sandwich ELISA Capture, KnockDown
Classification Monoclonal
Clone 2B3
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, ELISA, Immunohistochemistry 1:10-1:500, Immunoprecipitation, Immunohistochemistry-Paraffin 1:10-1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_112603
Gene Alias Alkaline phosphatase Nagao isozyme, alkaline phosphatase, placental-like, alkaline phosphatase, placental-like 2, ALP-1, ALPG, ALPPL, EC 3.1.3.1, GCAP, Germ cell alkaline phosphatase, Nagao isozyme, Placental alkaline phosphatase-like, placental-like alkaline phosphatase, PLAP-like, testicular and thymus alkaline phosphatase
Host Species Mouse
Immunogen ALPPL2 (NP_112603, 365 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Protein Phosphatase, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 251
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.