missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AlphaB Crystallin/CRYAB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49246
This item is not returnable.
View return policy
Description
AlphaB Crystallin/CRYAB Polyclonal antibody specifically detects AlphaB Crystallin/CRYAB in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| AlphaB Crystallin/CRYAB | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| alpha B crystallin, alpha(B)-crystallin, alpha-crystallin B chain, CRYA2alpha crystallin B chain, crystallin, alpha B, CTPP2, Heat shock protein beta-5, heat-shock 20 kD like-protein, HSPB5, Renal carcinoma antigen NY-REN-27, Rosenthal fiber component | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAA | |
| 0.1 mL | |
| Cancer, Cell Biology, Cell Cycle and Replication, Golgi Apparatus Markers, Membrane Trafficking and Chaperones, Neuroscience, Neurotransmission, Protein Phosphatase, Sensory Systems, Signal Transduction, Tyrosine Kinases, Vision | |
| 1410 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction