alpha-Taxilin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP2-56295

Codice prodotto. 18261075

Descrizione

alpha-Taxilin Polyclonal specifically detects alpha-Taxilin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifica

• Antigen: alpha-Taxilin
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: alpha-taxilin, DKFZp451J0118, IL14, interleukin 14, MGC118870, MGC118871, RP4-622L5.4, taxilin alpha, TXLN
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 200081
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: TXLNA
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVV
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only