missing translation for 'onlineSavingsMsg'
Learn More
Learn More
alpha-N-terminal Methyltransferase 1A/METTL11A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | alpha-N-terminal Methyltransferase 1A/METTL11A |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18226833
|
Novus Biologicals
NBP2-58554 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18617278
|
Novus Biologicals
NBP2-58554-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
alpha-N-terminal Methyltransferase 1A/METTL11A Polyclonal specifically detects alpha-N-terminal Methyltransferase 1A/METTL11A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| alpha-N-terminal Methyltransferase 1A/METTL11A | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 28989 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| AD-003, alpha N-terminal protein methyltransferase 1A, C9orf32, chromosome 9 open reading frame 32, EC 2.1.1.-, methyltransferase like 11A, Methyltransferase-like protein 11A, NRMT, N-terminal RCC1 methyltransferase, NTM1A, NTMT1, X-Pro-Lys N-terminal protein methyltransferase 1A | |
| NTMT1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title