missing translation for 'onlineSavingsMsg'
Learn More
Learn More
alpha-N-acetylgalactosaminidase/NAGA Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92593-0.02ml
This item is not returnable.
View return policy
Description
alpha-N-acetylgalactosaminidase/NAGA Polyclonal antibody specifically detects alpha-N-acetylgalactosaminidase/NAGA in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| alpha-N-acetylgalactosaminidase/NAGA | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| alpha-N- (alpha-galactosidase B), alpha-N-acetylgalactosaminidase, EC 3.2.1, EC 3.2.1.49, GALB, N-acetylgalactosaminidase, alpha- | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 312-411 of human NAGA (NP_000253.1). IQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQ | |
| 0.02 mL | |
| Cancer, Endocrinology, Signal Transduction | |
| 4668 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction