missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Alpha-mannosidase II Monoclonal antibody specifically detects Alpha-mannosidase II in Human, Mouse samples. It is validated for Western Blot, ELISA
Specifications
Specifications
| Antigen | Alpha-mannosidase II |
| Applications | Western Blot, ELISA |
| Classification | Monoclonal |
| Clone | 1G9 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_002363 |
| Gene Alias | alpha-mannosidase 2, AMan II, EC 3.2.1, EC 3.2.1.114, Golgi alpha-mannosidase II, golgi integral membrane protein 7, GOLIM7, Man II, MANA2MANII, Mannosidase alpha class 2A member 1, mannosidase, alpha type II, mannosidase, alpha, class 2A, member 1, Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase |
| Host Species | Mouse |
| Immunogen | MAN2A1 (NP_002363, 1045 a.a. ~ 1144 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFRIQLR |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?