missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Alpha Fodrin Rabbit anti-Human, Mouse, Rat, Clone: 9H5V8, Novus Biologicals™
Shop All Bio Techne ProductsDescription
Alpha Fodrin Monoclonal antibody specifically detects Alpha Fodrin in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | Alpha Fodrin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | 9H5V8 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | Alpha-II spectrin, EIEE5, FLJ17738, FLJ44613, Fodrin alpha chain, NEAS, spectrin alpha chain, brain, spectrin, alpha, non-erythrocytic 1 (alpha-fodrin), Spectrin, non-erythroid alpha chain, SPTA2 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Alpha Fodrin (Q13813). MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIV |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?