missing translation for 'onlineSavingsMsg'
Learn More
Learn More
alpha-Defensin 1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£169.00 - £401.00
Specifications
| Antigen | alpha-Defensin 1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18652598
|
Novus Biologicals
NBP3-05562-100ul |
100 μg |
£401.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18605967
|
Novus Biologicals
NBP3-05562-20ul |
20 μg |
£169.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
alpha-Defensin 1 Polyclonal antibody specifically detects alpha-Defensin 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| alpha-Defensin 1 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cancer, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 1667 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| alpha 2, DEF1DEFA1B, DEFA2, defensin, alpha 1, myeloid-related sequence, defensin, alpha 1HP-1, HNP-1HP1, MRSMGC138393, myeloid-related sequence, neutrophil defensin 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-94 of human alpha-Defensin 1 (NP_004075.1). MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title