missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16307384

Invitrogen™ alpha Actinin 3 Polyclonal Antibody, DyLight™ 488
GREENER_CHOICE

Product Code. 16307384
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16307384 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16307384 Supplier Invitrogen™ Supplier No. PA578719

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - Flow: A431 cell.

Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele.
TRUSTED_SUSTAINABILITY

Specifications

Antigen alpha Actinin 3
Applications Flow Cytometry
Classification Polyclonal
Concentration 0.5 mg/mL
Conjugate DyLight 488
Formulation PBS with 50% glycerol and 0.02% sodium azide
Gene Actn3
Gene Accession No. Q08043
Gene Alias actinin alpha 3; actinin alpha 3 (gene/pseudogene); Actinin alpha3; actinin, alpha 3; Actinin-alpha3; ACTN3; alpha-actinin skeletal muscle; Alpha-actinin skeletal muscle isoform 3; alpha-Actinin3; Alpha-actinin-3; alphaActinin-3; F-actin cross-linking protein
Gene Symbols Actn3
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 89
Target Species Human
Content And Storage -20°C, Avoid Freeze/Thaw Cycles, store in dark
Product Type Antibody
Form Liquid
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.