missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. alpha-2B Adrenergic R/ADRA2B Rabbit anti-Human, Polyclonal, Novus Biologicals™

alpha-2B Adrenergic R/ADRA2B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Codice prodotto. 18338396 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantity:
100 μg
25 μg
Dimensione della confezione:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantity unitSize
18338396 25 μg 25µL
18358471 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18338396 Fornitore Novus Biologicals N. del fornitore NBP31779925UL

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody

alpha-2B Adrenergic R/ADRA2B Polyclonal antibody specifically detects alpha-2B Adrenergic R/ADRA2B in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifica

Antigen alpha-2B Adrenergic R/ADRA2B
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias ADRA2B adrenergic, alpha-2B-, receptor, ADRA2L1adrenergic receptor alpha 2B, ADRA2RL1, ADRARL1, adrenergic, alpha-2B-, receptor, Alpha-2 adrenergic receptor subtype C2, alpha-2-adrenergic receptor-like 1, alpha-2B adrenergic receptor, Alpha-2B adrenoceptor, Alpha-2B adrenoreceptor, alpha-2B-adrenergic receptor, Alpha-2BAR, ALPHA2BAR, G-protein coupled receptor
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTF
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Adaptive Immunity, GPCR, Immunology, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 151
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.