missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Allergin-1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Allergin-1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18358224 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18358224 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18358224 Supplier Novus Biologicals Supplier No. NBP310749100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Allergin-1 Polyclonal specifically detects Allergin-1 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Allergin-1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias Allergin-1, Allergy Inhibitory Receptor 1, C17orf60, Chromosome 17 Open Reading Frame 60, Mast Cell Antigen 32, Mast Cell Immunoglobulin-Like Receptor 1, MCA32, MCA-32, Probable Mast Cell Antigen 32 Homolog
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human Allergin-1 (NP_001078892). Peptide sequence KTRKAMRNNVPRDRGDTAMEVGIYANILEKQAKEESVPEVGSRPCVSTAQ
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 284021
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.