missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ALKBH8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38428-25ul
This item is not returnable.
View return policy
Description
ALKBH8 Polyclonal specifically detects ALKBH8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| ALKBH8 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q96BT7 | |
| ALKBH8 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TVQASESLKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKETPPSFPESDKEASRLEQEYVHQVYEEIAGHFSSTR | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ABH8MGC10235, AlkB homologue 8, alkB, alkylation repair homolog 8 (E. coli), alkylated DNA repair protein alkB homolog 8, EC 1.14.11.-, EC 2.1.1.-, FLJ38204, Probable alpha-ketoglutarate-dependent dioxygenase ABH8, S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 91801 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction