missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Alkaline Phosphatase, Intestinal Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £460.95
Specifications
| Antigen | Alkaline Phosphatase, Intestinal |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18429761
|
Novus Biologicals
NBP2-33624-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18161104
|
Novus Biologicals
NBP2-33624 |
0.1 mL |
£488.00 £460.95 / 0.10mL Save £27.05 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Alkaline Phosphatase, Intestinal Polyclonal specifically detects Alkaline Phosphatase, Intestinal in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Alkaline Phosphatase, Intestinal | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P09923 | |
| 248 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FQTIGLSAAARFNQCNTTRGNEVISVMNRAK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Embryonic Stem Cell Markers, Lipid and Metabolism, Protein Phosphatase, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| alkaline phosphatase, intestinal, alkaline phosphomonoesterase, EC 3.1.3.1, glycerophosphatase, IAP, Intestinal alkaline phosphatase, intestinal-type alkaline phosphatase, Kasahara isozyme | |
| ALPI | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title