missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ALK-1 Monoclonal antibody specifically detects ALK-1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence
Specifications
Specifications
| Antigen | ALK-1 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 8L2V7 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | activin A receptor type II-like 1, activin A receptor, type II-like kinase 1, Activin receptor-like kinase 1, ACVRLK1ORW2, ALK-1, ALK1TGF-B superfamily receptor type I, EC 2.7.11, HHT, HHT2EC 2.7.11.30, serine/threonine-protein kinase receptor R3, SKR3, TSR-I |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 404-503 of human ALK-1 (P37023). VLWEIARRTIVNGIVEDYRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQKISNSPEKPKVIQ |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?