missing translation for 'onlineSavingsMsg'
Learn More

ALG12 Antibody (5E3), Novus Biologicals™

Product Code. 18403389 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18403389 0.1 mg 0.1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18403389 Supplier Novus Biologicals Supplier No. H00079087M06

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

ALG12 Monoclonal antibody specifically detects ALG12 in Human, Rat samples. It is validated for Western Blot, ELISA, Sandwich ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen ALG12
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 5E3
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_077010
Gene Alias alpha-1,6-mannosyltransferase), asparagine-linked glycosylation 12 homolog (S. cerevisiae, asparagine-linked glycosylation 12 homolog (yeast, asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 12 homolog, CDG1G, dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase, dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase, EC 2.4.1.-, ECM39, hALG12, Mannosyltransferase ALG12 homolog, Membrane protein SB87, MGC111358, MGC3136, PP14673
Host Species Mouse
Immunogen ALG12 (NP_077010, 369 a.a. ∽ 425 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPGTG
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79087
Target Species Human, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.