ALG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69510

Product Code. 18284813

Description

ALG1 Polyclonal antibody specifically detects ALG1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ALG1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: asparagine-linked glycosylation 1 homolog (yeast, beta-1,4-mannosyltransferase), asparagine-linked glycosylation 1, beta-1,4-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 1 homolog, beta-1,4 mannosyltransferase, beta-1,4-mannosyltransferase, chitobiosyldiphosphodolichol beta-mannosyltransferase, GDP-Man:GlcNAc2-PP-dolichol mannosyltransferase, GDP-mannose-dolichol diphosphochitobiose mannosyltransferase, hMat-1, HMAT1EC 2.4.1.142, HMT-1, HMT1CDG1K, Mannosyltransferase-1, MT-1
• Host Species: Rabbit
• Molecular Weight of Antigen: 52 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Mouse: 85%; Rat: 79%; Bovine: 79%; .
• Target Species: Human, Mouse, Rat, Bovine, Rabbit, Yeast
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BT22
• Gene Symbols: ALG1
• Immunogen: Synthetic peptides corresponding to ALG1(asparagine-linked glycosylation 1 homolog) The peptide sequence was selected from the N terminal of ALG1. Peptide sequence VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56052
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only