Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00057016-M01

Product Code. 18461459

Description

Aldo-keto Reductase 1B10/AKR1B10 Monoclonal antibody specifically detects Aldo-keto Reductase 1B10/AKR1B10 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), Sandwich ELISA

Specifications

• Antigen: Aldo-keto Reductase 1B10/AKR1B10
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: AKR1B11, AKR1B12, aldo-keto reductase family 1 member B10, aldo-keto reductase family 1, member B10 (aldose reductase), aldo-keto reductase family 1, member B11 (aldose reductase-like), Aldose reductase-like, aldose reductase-like 1, aldose reductase-like peptide, Aldose reductase-related protein, ALDRLn, ARL1, ARL-1SI reductase, ARP, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.21, hARP, HIS, HSI, MGC14103, Small intestine reductase
• Immunogen: AKR1B10 (NP_064695, 76 a.a. ∽ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE
• Quantity: 0.1 mg
• Research Discipline: Cancer, Lipid and Metabolism
• Gene ID (Entrez): 57016
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ

• Applications: Western Blot, ELISA, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Sandwich ELISA
• Clone: 1A6
• Dilution: Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA
• Gene Accession No.: NP_064695
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified