missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ALDH7A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | ALDH7A1 |
|---|---|
| Dilution | Western Blot 1:100 - 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231397
|
Novus Biologicals
NBP3-38572-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30229164
|
Novus Biologicals
NBP3-38572-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ALDH7A1 Polyclonal antibody specifically detects ALDH7A1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ImmunofluorescenceSpecifications
| ALDH7A1 | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.3), 50% glycerol | |
| 501 | |
| IgG | |
| Affinity purified |
| Western Blot 1:100 - 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| aldehyde dehydrogenase 7 family, member A1, Aldehyde dehydrogenase family 7 member A1,26g turgor protein homolog, Alpha-AASA dehydrogenase, ATQ1Antiquitin-1, Betaine aldehyde dehydrogenase, Delta1-piperideine-6-carboxylate dehydrogenase, EC 1.2.1, EC 1.2.1.3, EC 1.2.1.31, EC 1.2.1.8, EPDalpha-aminoadipic semialdehyde dehydrogenase, FLJ11738, FLJ92814, P6c dehydrogenase, PDEantiquitin-1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 430-539 of human ALDH7A1 (NP_001173.2).,, Sequence:, APILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title