missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ALDH1L2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68750-25ul
This item is not returnable.
View return policy
Description
ALDH1L2 Polyclonal antibody specifically detects ALDH1L2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| ALDH1L2 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| aldehyde dehydrogenase 1 family, member L2, aldehyde dehydrogenase family 1 member L2, DKFZp686A16126, DKFZp686M064, EC 1.5.1.6, FLJ36769, FLJ38508, MGC119536, MGC119537,10-formyltetrahydrofolate dehydrogenase ALDH1L2, Mitochondrial 10-formyltetrahydrofolate dehydrogenase, mtFDHDKFZp686P14145, probable 10-formyltetrahydrofolate dehydrogenase ALDH1L2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KCGGLQLQNEDVYMATKFEGFIQKVVRKLRGEDQEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKT | |
| 25 μL | |
| Amino Acids Drugs and other small molecules, Cancer, Endocrinology, Signal Transduction | |
| 160428 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction