missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Aldehyde dehydrogenase 5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Aldehyde dehydrogenase 5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18386706 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18386706 100 μg 100µL
18306774 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18386706 Supplier Novus Biologicals Supplier No. NBP317798100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Aldehyde dehydrogenase 5 Polyclonal antibody specifically detects Aldehyde dehydrogenase 5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Aldehyde dehydrogenase 5
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias aldehyde dehydrogenase 1 family, member B1, Aldehyde dehydrogenase 5, Aldehyde dehydrogenase family 1 member B1, ALDH class 2, ALDH5aldehyde dehydrogenase X, mitochondrial, ALDHXacetaldehyde dehydrogenase 5, EC 1.2.1, EC 1.2.1.3, MGC2230, mitochondrial aldehyde dehydrogenase X
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: ESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQK
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 219
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.