alcohol dehydrogenase 1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-46861-25ul

Product Code. 18646665

Description

alcohol dehydrogenase 1A Polyclonal antibody specifically detects alcohol dehydrogenase 1A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: alcohol dehydrogenase 1A
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: P07327
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Gene Alias: ADH, alpha subunit, ADH1alcohol dehydrogenase 1A, alcohol dehydrogenase 1 (class I), alpha polypeptide, alcohol dehydrogenase 1A (class I), alpha polypeptide, Alcohol dehydrogenase subunit alpha, aldehyde reductase, EC 1.1.1, EC 1.1.1.1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IPQCGKCRICKNPESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHF
• Quantity: 25 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 124
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG