missing translation for 'onlineSavingsMsg'
Learn More
Learn More
alcohol dehydrogenase 1A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-46861
This item is not returnable.
View return policy
Description
alcohol dehydrogenase 1A Polyclonal antibody specifically detects alcohol dehydrogenase 1A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| alcohol dehydrogenase 1A | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| P07327 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| ADH, alpha subunit, ADH1alcohol dehydrogenase 1A, alcohol dehydrogenase 1 (class I), alpha polypeptide, alcohol dehydrogenase 1A (class I), alpha polypeptide, Alcohol dehydrogenase subunit alpha, aldehyde reductase, EC 1.1.1, EC 1.1.1.1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: IPQCGKCRICKNPESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHF | |
| 0.1 mL | |
| metabolism | |
| 124 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction