AKT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55812

Product Code. 18299814

Description

AKT2 Polyclonal specifically detects AKT2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: AKT2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: EC 2.7.11, EC 2.7.11.1, Murine thymoma viral (v-akt) homolog-2, PKB beta, PKBB, PKBBETA, PRKBB, Protein kinase Akt-2, Protein kinase B beta, rac protein kinase beta, RAC-BETA, RAC-beta serine/threonine-protein kinase, RAC-PK-beta, v-akt murine thymoma viral oncogene homolog 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: AKT2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMND
• Quantity: 100 μL
• Research Discipline: Apoptosis, Autophagy, Cancer, Growth and Development, Hypoxia, mTOR Pathway, Neuronal Cell Markers, Protein Kinase, Signal Transduction
• Gene ID (Entrez): 208
• Target Species: Human
• Isotype: IgG

For Research Use Only