AKR1D1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-74082

Product Code. 18254082

Description

AKR1D1 Polyclonal specifically detects AKR1D1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AKR1D1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 3o5bred, Aldo-keto reductase family 1 member D1,3-oxo-5-beta-steroid 4-dehydrogenase, aldo-keto reductase family 1, member D1 (delta4-3-ketosteroid-5-beta-reductase), CBAS2, Delta(4)-3-oxosteroid 5-beta-reductase, EC 1.3.1.3, SRD5B1beta polypeptide 1 (3-oxo-5 beta-steroid delta4-dehydrogenase beta 1)
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 6718
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P51857
• Gene Symbols: AKR1D1
• Immunogen: Synthetic peptides corresponding to the middle region of AKR1D1 (NP_005980). Peptide Sequence: YVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGL
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 85%; Pig: 86%; Bovine: 86%; Rat: 77%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG