missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AKR1CL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £470.00
Specifications
| Antigen | AKR1CL2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18450392
|
Novus Biologicals
NBP1-90195-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18276007
|
Novus Biologicals
NBP1-90195 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
AKR1CL2 Polyclonal specifically detects AKR1CL2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| AKR1CL2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q96JD6 | |
| 83592 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| AF reductase, AKR1CL2, AKRDC1, Aldo-keto reductase family 1 member C-like protein 21,5-anhydro-D-fructose reductase, Aldo-keto reductase family 1 member E2, aldo-keto reductase family 1, member C-like 2, aldo-keto reductase family 1, member E2, aldo-keto reductase loopADR, aldo-keto reductase related protein, EC 1.1.1, EC 1.1.1.263, hTSP, LoopADR, MGC10612, Testis-specific protein | |
| AKR1E2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title