AKR1C2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57769

Product Code. 18256762

Description

AKR1C2 Polyclonal specifically detects AKR1C2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AKR1C2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: aldo-keto reductase family 1 member C2, aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acidbinding protein; 3-alpha hydroxysteroid dehydrogenase, type III), BABP, Chlordecone reductase homolog HAKRD, DD, DD-2, DD2DD/BABP, DDH2FLJ53800, Dihydrodiol dehydrogenase 2, Dihydrodiol dehydrogenase/bile acid-binding protein, EC 1.1.1,3-alpha-HSD3, EC 1.1.1.213, EC 1.3.1.20, HAKRDAKR1C-pseudo, HBAB, MCDR2, pseudo-chlordecone reductase, Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase, type II dihydrodiol dehydrogenase, Type III 3-alpha-hydroxysteroid dehydrogenase
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1646
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P52895
• Gene Symbols: AKR1C2
• Immunogen: Synthetic peptide directed towards the N terminal of human AKR1C2 (NP_995317). Peptide sequence: LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 85%; Xenopus: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG