missing translation for 'onlineSavingsMsg'
Learn More

Akirin2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

£359.00

Specifications

Antigen	Akirin2
Dilution	Western Blot 1.0 ug/ml
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18386964 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP3-10695-100UL	100 μg	£359.00 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

Akirin2 Polyclonal specifically detects Akirin2 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	Akirin2
Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Mouse
Gene Alias	akirin 2, akirin-2, C6orf166, chromosome 6 open reading frame 166, dJ486L4.2, FBI1, FLJ10342, fourteen-three-three beta interactant 1
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Akirin2 (NP_001007590). Peptide sequence CERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASY
Purification Method	Affinity purified

Dilution	Western Blot 1.0 ug/ml
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Formulation	PBS buffer, 2% sucrose
Gene ID (Entrez)	55122
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

Akirin2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Specifications

Description

Specifications

Documents